Lineage for d1b8ia_ (1b8i A:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families) 
consists only of helicesFamily a.4.1.1: Homeodomain [46690] (41 proteins)
Pfam PF00046
Protein Ultrabithorax (ubx) homeodomain [46718] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46719] (1 PDB entry) 
Domain d1b8ia_: 1b8i A: [16010]
Other proteins in same PDB: d1b8ib_
protein/DNA complex
Details for d1b8ia_
PDB Entry: 1b8i (more details), 2.4 Å
PDB Description: structure of the homeotic ubx/exd/dna ternary complex
PDB Compounds: (A:) protein (ultrabithorax homeotic protein IV)SCOPe Domain Sequences for d1b8ia_:
Sequence, based on SEQRES records: (download)
>d1b8ia_ a.4.1.1 (A:) Ultrabithorax (ubx) homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
fypwmaiagtnglrrrgrqtytryqtlelekefhtnhyltrrrriemahalslterqiki
wfqnrrmklkkei
Sequence, based on observed residues (ATOM records): (download)
>d1b8ia_ a.4.1.1 (A:) Ultrabithorax (ubx) homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
fypwmarqtytryqtlelekefhtnhyltrrrriemahalslterqikiwfqnrrmklkk
ei
SCOPe Domain Coordinates for d1b8ia_:
Click to download the PDB-style file with coordinates for d1b8ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8ia_:
- d1b8ia_ first appeared (with stable ids) in SCOP 1.55
- d1b8ia_ appears in SCOPe 2.02
- d1b8ia_ appears in SCOPe 2.04
- d1b8ia_ appears in the current release, SCOPe 2.08
View in 3D
