Lineage for d1avqa_ (1avq A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1170598Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1170763Family c.52.1.13: lambda exonuclease [53017] (1 protein)
  6. 1170764Protein lambda exonuclease [53018] (1 species)
  7. 1170765Species Bacteriophage lambda [TaxId:10710] [53019] (3 PDB entries)
  8. 1170767Domain d1avqa_: 1avq A: [33326]
    complexed with act, po4

Details for d1avqa_

PDB Entry: 1avq (more details), 2.4 Å

PDB Description: toroidal structure of lambda exonuclease determined at 2.4 angstroms
PDB Compounds: (A:) lambda exonuclease

SCOPe Domain Sequences for d1avqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avqa_ c.52.1.13 (A:) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]}
shmtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyf
htllaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacsp
dglcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydpr
mkreglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

SCOPe Domain Coordinates for d1avqa_:

Click to download the PDB-style file with coordinates for d1avqa_.
(The format of our PDB-style files is described here.)

Timeline for d1avqa_: