Lineage for d1alua_ (1alu A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767024Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 767065Protein Interleukin-6 [47272] (2 species)
  7. 767066Species Human (Homo sapiens) [TaxId:9606] [47273] (4 PDB entries)
  8. 767067Domain d1alua_: 1alu A: [16826]
    complexed with so4, tar

Details for d1alua_

PDB Entry: 1alu (more details), 1.9 Å

PDB Description: human interleukin-6
PDB Compounds: (A:) interleukin-6

SCOP Domain Sequences for d1alua_:

Sequence, based on SEQRES records: (download)

>d1alua_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records): (download)

>d1alua_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnmcenlnlpkmaekdgcfqsgfneetclvki
itgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdpttnasl
ltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

SCOP Domain Coordinates for d1alua_:

Click to download the PDB-style file with coordinates for d1alua_.
(The format of our PDB-style files is described here.)

Timeline for d1alua_: