Lineage for d1ai9a_ (1ai9 A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the restSuperfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) 
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species) 
Species Yeast (Candida albicans) [TaxId:5476] [53609] (12 PDB entries) 
Domain d1ai9a_: 1ai9 A: [34925]
complexed with ndp
Details for d1ai9a_
PDB Entry: 1ai9 (more details), 1.85 Å
PDB Description: candida albicans dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductaseSCOPe Domain Sequences for d1ai9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ai9a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk
SCOPe Domain Coordinates for d1ai9a_:
Click to download the PDB-style file with coordinates for d1ai9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ai9a_:
- d1ai9a_ first appeared (with stable ids) in SCOP 1.55
- d1ai9a_ appears in SCOP 1.75
- d1ai9a_ appears in SCOPe 2.02
- d1ai9a_ appears in the current release, SCOPe 2.08
View in 3D
