Lineage for d1ag9a_ (1ag9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856359Protein Flavodoxin [52220] (11 species)
  7. 2856426Species Escherichia coli [TaxId:562] [52224] (2 PDB entries)
  8. 2856427Domain d1ag9a_: 1ag9 A: [31178]
    complexed with btb, ca, cl, fmn, na

Details for d1ag9a_

PDB Entry: 1ag9 (more details), 1.8 Å

PDB Description: flavodoxins that are required for enzyme activation: the structure of oxidized flavodoxin from escherichia coli at 1.8 angstroms resolution.
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1ag9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]}
aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhldeilna

SCOPe Domain Coordinates for d1ag9a_:

Click to download the PDB-style file with coordinates for d1ag9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ag9a_: