Lineage for d1afva_ (1afv A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495228Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1495229Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1495230Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1495269Protein HIV-1 capsid protein [47945] (1 species)
  7. 1495270Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (30 PDB entries)
  8. 1495334Domain d1afva_: 1afv A: [18324]
    Other proteins in same PDB: d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvl2, d1afvm1, d1afvm2
    complexed with pb

Details for d1afva_

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3
PDB Compounds: (A:) human immunodeficiency virus type 1 capsid protein

SCOPe Domain Sequences for d1afva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afva_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsil

SCOPe Domain Coordinates for d1afva_:

Click to download the PDB-style file with coordinates for d1afva_.
(The format of our PDB-style files is described here.)

Timeline for d1afva_: