Lineage for d1aeca_ (1aec A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1888976Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1889128Protein Actinidin [54003] (1 species)
  7. 1889129Species Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId:3625] [54004] (2 PDB entries)
  8. 1889131Domain d1aeca_: 1aec A: [37003]
    complexed with e64

Details for d1aeca_

PDB Entry: 1aec (more details), 1.86 Å

PDB Description: crystal structure of actinidin-e-64 complex+
PDB Compounds: (A:) actinidin

SCOPe Domain Sequences for d1aeca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]}
lpsyvdwrsagavvdiksqgecggcwafsaiatveginkivtgvlislseqelidcgrtq
ntrgcnggyitdgfqfiinngginteenypytaqdgecnvdlqnekyvtidtyenvpynn
ewalqtavtyqpvsvaldaagdafkqyssgiftgpcgtaidhavtivgygteggidywiv
knswdttwgeegymrilrnvggagtcgiatmpsypvky

SCOPe Domain Coordinates for d1aeca_:

Click to download the PDB-style file with coordinates for d1aeca_.
(The format of our PDB-style files is described here.)

Timeline for d1aeca_: