Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Actinidin [54003] (1 species) |
Species Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId:3625] [54004] (2 PDB entries) |
Domain d1aeca_: 1aec A: [37003] complexed with e64 |
PDB Entry: 1aec (more details), 1.86 Å
SCOPe Domain Sequences for d1aeca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} lpsyvdwrsagavvdiksqgecggcwafsaiatveginkivtgvlislseqelidcgrtq ntrgcnggyitdgfqfiinngginteenypytaqdgecnvdlqnekyvtidtyenvpynn ewalqtavtyqpvsvaldaagdafkqyssgiftgpcgtaidhavtivgygteggidywiv knswdttwgeegymrilrnvggagtcgiatmpsypvky
Timeline for d1aeca_: