Lineage for d1a04a2 (1a04 A:5-142)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (7 families) 
Family c.23.1.1: CheY-related [52173] (25 proteins) 
Protein Nitrate/nitrite response regulator (NarL), receiver domain [52178] (1 species) Species Escherichia coli [TaxId:562] [52179] (2 PDB entries) 
Domain d1a04a2: 1a04 A:5-142 [31089]
Other proteins in same PDB: d1a04a1, d1a04b1
Details for d1a04a2
PDB Entry: 1a04 (more details), 2.2 Å
PDB Description: the structure of the nitrate/nitrite response regulator protein narl in the monoclinic c2 crystal form
PDB Compounds: (A:) nitrate/nitrite response regulator protein narlSCOP Domain Sequences for d1a04a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]}
epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg
mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa
agemvlsealtpvlaasl
SCOP Domain Coordinates for d1a04a2:
Click to download the PDB-style file with coordinates for d1a04a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a04a2:
- d1a04a2 first appeared (with stable ids) in SCOP 1.55
- d1a04a2 appears in SCOP 1.73
- d1a04a2 appears in SCOPe 2.01
- d1a04a2 appears in the current release, SCOPe 2.08
View in 3D
