Lineage for d1a04a2 (1a04 A:5-142)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855566Protein Nitrate/nitrite response regulator (NarL), receiver domain [52178] (1 species)
  7. 2855567Species Escherichia coli [TaxId:562] [52179] (2 PDB entries)
  8. 2855568Domain d1a04a2: 1a04 A:5-142 [31089]
    Other proteins in same PDB: d1a04a1, d1a04b1

Details for d1a04a2

PDB Entry: 1a04 (more details), 2.2 Å

PDB Description: the structure of the nitrate/nitrite response regulator protein narl in the monoclinic c2 crystal form
PDB Compounds: (A:) nitrate/nitrite response regulator protein narl

SCOPe Domain Sequences for d1a04a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]}
epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg
mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa
agemvlsealtpvlaasl

SCOPe Domain Coordinates for d1a04a2:

Click to download the PDB-style file with coordinates for d1a04a2.
(The format of our PDB-style files is described here.)

Timeline for d1a04a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a04a1