Lineage for d1ufoa_ (1ufo A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842916Family c.69.1.27: Hypothetical protein TT1662 [102616] (1 protein)
  6. 842917Protein Hypothetical protein TT1662 [102617] (1 species)
  7. 842918Species Thermus thermophilus [TaxId:274] [102618] (1 PDB entry)
  8. 842919Domain d1ufoa_: 1ufo A: [99344]
    structural genomics

Details for d1ufoa_

PDB Entry: 1ufo (more details), 1.6 Å

PDB Description: Crystal Structure of TT1662 from Thermus thermophilus
PDB Compounds: (A:) hypothetical protein TT1662

SCOP Domain Sequences for d1ufoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}
mrvrterltlaglsvlaripeapkalllalhglqgskehilallpgyaergflllafdap
rhgeregpppsskspryveevyrvalgfkeearrvaeeaerrfglplflaggslgafvah
lllaegfrprgvlafigsgfpmklpqgqvvedpgvlalyqappatrgeayggvpllhlhg
srdhivplarmektlealrphypegrlarfveegaghtltplmarvglaflehwlear

SCOP Domain Coordinates for d1ufoa_:

Click to download the PDB-style file with coordinates for d1ufoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ufoa_: