Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins) |
Protein Hypothetical protein rbstp0775 [102358] (1 species) structural similarity to PanK |
Species Bacillus stearothermophilus [TaxId:1422] [102359] (1 PDB entry) |
Domain d1rz3a_: 1rz3 A: [98132] structural genomics complexed with act, ca |
PDB Entry: 1rz3 (more details), 1.9 Å
SCOP Domain Sequences for d1rz3a_:
Sequence, based on SEQRES records: (download)
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} melrdridflcktilaiktagrlvlgidglsrsgkttlanqlsqtlreqgisvcvfhmdd hiverakryhtgneewfeyyylqwdvewlthqlfrqlkashqltlpfydhetdthskrtv ylsdsdmimiegvflqrkewrpffdfvvyldcpreirfarendqvkqniqkfinrywkae dyyleteepikradvvfd
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} melrdridflcktilaiktagrlvlgidglsrsgkttlanqlsqtlreqgisvcvfhmdd hiverakryhtgneewfeyyylqwdvewlthqlfrqlkashqltlpfydhetdthskrtv ylsdsdmimiegvflqrkewrpffdfvvyldcpniqkfinrywkaedyyleteepikrad vvfd
Timeline for d1rz3a_: