![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins) |
![]() | Protein Hypothetical protein rbstp0775 [102358] (1 species) structural similarity to PanK |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [102359] (1 PDB entry) |
![]() | Domain d1rz3a_: 1rz3 A: [98132] structural genomics complexed with act, ca |
PDB Entry: 1rz3 (more details), 1.9 Å
SCOP Domain Sequences for d1rz3a_:
Sequence, based on SEQRES records: (download)
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus} melrdridflcktilaiktagrlvlgidglsrsgkttlanqlsqtlreqgisvcvfhmdd hiverakryhtgneewfeyyylqwdvewlthqlfrqlkashqltlpfydhetdthskrtv ylsdsdmimiegvflqrkewrpffdfvvyldcpreirfarendqvkqniqkfinrywkae dyyleteepikradvvfd
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus} melrdridflcktilaiktagrlvlgidglsrsgkttlanqlsqtlreqgisvcvfhmdd hiverakryhtgneewfeyyylqwdvewlthqlfrqlkashqltlpfydhetdthskrtv ylsdsdmimiegvflqrkewrpffdfvvyldcpniqkfinrywkaedyyleteepikrad vvfd
Timeline for d1rz3a_: