Lineage for d1qwda_ (1qwd A:)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily)
barrel, closed or opened; n=8, S=12; meanderSuperfamily b.60.1: Lipocalins [50814] (9 families) 
bind hydrophobic ligands in their interiorFamily b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
barrel, closed; n=8, S=12, meander
Protein Outer membrane lipoprotein Blc [101861] (1 species)
bacterial lipocalinSpecies Escherichia coli [TaxId:562] [101862] (1 PDB entry) 
Domain d1qwda_: 1qwd A: [96471]
Details for d1qwda_
PDB Entry: 1qwd (more details), 1.75 Å
PDB Description: crystal structure of a bacterial lipocalin, the blc gene product from e. coli
PDB Compounds: (A:) Outer membrane lipoprotein blcSCOP Domain Sequences for d1qwda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]}
hlestslykkssstpprgvtvvnnfdakrylgtwyeiarfdhrferglekvtatyslrdd
gglnvinkgynpdrgmwqqsegkayftgaptraalkvsffgpfyggynvialdreyrhal
vcgpdrdylwilsrtptisdevkqemlavatregfdvskfiwvqqpg
SCOP Domain Coordinates for d1qwda_:
Click to download the PDB-style file with coordinates for d1qwda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qwda_:
- d1qwda_ first appeared in SCOP 1.67
- d1qwda_ appears in SCOP 1.73
- d1qwda_ appears in SCOPe 2.01
- d1qwda_ appears in the current release, SCOPe 2.08, called d1qwda1
View in 3D
