Lineage for d1q8ba_ (1q8b A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861406Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 861522Family d.58.4.6: Hypothetical protein YjcS [102962] (1 protein)
  6. 861523Protein Hypothetical protein YjcS [102963] (1 species)
  7. 861524Species Bacillus subtilis [TaxId:1423] [102964] (1 PDB entry)
  8. 861525Domain d1q8ba_: 1q8b A: [96201]
    structural genomics; monomeric form?

Details for d1q8ba_

PDB Entry: 1q8b (more details), 1.9 Å

PDB Description: Structural Genomics, protein YJCS
PDB Compounds: (A:) Protein yjcS

SCOP Domain Sequences for d1q8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ba_ d.58.4.6 (A:) Hypothetical protein YjcS {Bacillus subtilis [TaxId: 1423]}
smhyitaclkiisdkdlneimkefkkleeetnkeegcitfhayplepserkimlweiwen
eeavkihftkkhtidvqkqeltevewlmksnvn

SCOP Domain Coordinates for d1q8ba_:

Click to download the PDB-style file with coordinates for d1q8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1q8ba_: