Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.6: Hypothetical protein YjcS [102962] (1 protein) |
Protein Hypothetical protein YjcS [102963] (1 species) |
Species Bacillus subtilis [TaxId:1423] [102964] (1 PDB entry) |
Domain d1q8ba_: 1q8b A: [96201] structural genomics; monomeric form? |
PDB Entry: 1q8b (more details), 1.9 Å
SCOPe Domain Sequences for d1q8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8ba_ d.58.4.6 (A:) Hypothetical protein YjcS {Bacillus subtilis [TaxId: 1423]} smhyitaclkiisdkdlneimkefkkleeetnkeegcitfhayplepserkimlweiwen eeavkihftkkhtidvqkqeltevewlmksnvn
Timeline for d1q8ba_: