Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins) duplication: consists of two domains of this fold |
Protein 3-mercaptopyruvate sulfurtransferase [102427] (2 species) |
Species Leishmania major [TaxId:5664] [102428] (1 PDB entry) |
Domain d1okga1: 1okg A:7-162 [93250] Other proteins in same PDB: d1okga3 |
PDB Entry: 1okg (more details), 2.1 Å
SCOP Domain Sequences for d1okga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} apkhpgkvfldpsevadhlaeyrivdcryslkikdhgsiqyakehvksairadvdtnlsk lvptstarhplppcaefidwcmangmagelpvlcyddecgamggcrlwwmlnslgadayv inggfqackaaglemesgepsslprpathwpfktaf
Timeline for d1okga1: