Lineage for d1ogia2 (1ogi A:142-303)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
binds NADP differently than classical Rossmann-fold
N-terminal FAD-linked domain contains (6,10) barrelFamily c.25.1.1: Reductases [52344] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (24 PDB entries) 
Domain d1ogia2: 1ogi A:142-303 [92915]
Other proteins in same PDB: d1ogia1
complexed with fad, so4; mutant
Details for d1ogia2
PDB Entry: 1ogi (more details), 1.64 Å
PDB Description: ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly and ala 160 replaced by thr (t155g-a160t)
PDB Compounds: (A:) ferredoxin--nadp+ reductaseSCOP Domain Sequences for d1ogia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogia2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}
lpddpeanvimlaggtgitpmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
SCOP Domain Coordinates for d1ogia2:
Click to download the PDB-style file with coordinates for d1ogia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ogia2:
- d1ogia2 first appeared in SCOP 1.67
- d1ogia2 appears in SCOP 1.73
- d1ogia2 appears in SCOPe 2.01
- d1ogia2 appears in the current release, SCOPe 2.08
View in 3D
