Lineage for d1iura_ (1iur A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760198Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 760199Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 760221Protein Hypothetical protein KIAA0730 [100982] (1 species)
  7. 760222Species Human (Homo sapiens) [TaxId:9606] [100983] (1 PDB entry)
    structural genomics
  8. 760223Domain d1iura_: 1iur A: [90704]

Details for d1iura_

PDB Entry: 1iur (more details)

PDB Description: dnaj domain of human kiaa0730 protein
PDB Compounds: (A:) KIAA0730 protein

SCOP Domain Sequences for d1iura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}
mhhhhhhlvprgsilkevtsvveqawklpeserkkiirrlylkwhpdknpenhdianevf
khlqneinrlekqafldqnadrasrrtf

SCOP Domain Coordinates for d1iura_:

Click to download the PDB-style file with coordinates for d1iura_.
(The format of our PDB-style files is described here.)

Timeline for d1iura_: