SCOPe 2.08: Domain d1iura1: 1iur A:14-88

Lineage for d1iura1 (1iur A:14-88)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
   Pfam PF00226

6. Protein Hypothetical protein KIAA0730 [100982] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [100983] (1 PDB entry)
   structural genomics

8. Domain d1iura1: 1iur A:14-88 [90704]
   Other proteins in same PDB: d1iura2

Details for d1iura1

PDB Entry: 1iur

PDB Description: dnaj domain of human kiaa0730 protein

PDB Compounds: (A:) KIAA0730 protein

SCOPe Domain Sequences for d1iura1:

Sequence; same for both SEQRES and ATOM records:

>d1iura1 a.2.3.1 (A:14-88) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}
ilkevtsvveqawklpeserkkiirrlylkwhpdknpenhdianevfkhlqneinrlekq
afldqnadrasrrtf

Timeline for d1iura1:

• d1iura1 first appeared in SCOP 1.67, called d1iura_
  
• d1iura1 appears in SCOPe 2.07