Lineage for d1pk5a_ (1pk5 A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins) 
Protein Orphan nuclear receptor NR5a2 (LRH-1) [89147] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [89148] (1 PDB entry) 
Domain d1pk5a_: 1pk5 A: [88139]
Details for d1pk5a_
PDB Entry: 1pk5 (more details), 2.4 Å
PDB Description: Crystal structure of the orphan nuclear receptor LRH-1
PDB Compounds: (A:) Orphan nuclear receptor NR5A2SCOP Domain Sequences for d1pk5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]}
asiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtlfsive
warssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdystiis
htevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegvqeqvn
aalldytvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlliemlha
kr
SCOP Domain Coordinates for d1pk5a_:
Click to download the PDB-style file with coordinates for d1pk5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pk5a_:
- d1pk5a_ first appeared in SCOP 1.65
- d1pk5a_ appears in SCOP 1.73
- d1pk5a_ appears in SCOPe 2.01
- d1pk5a_ appears in the current release, SCOPe 2.08
View in 3D
