![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.1: PhoB-like [46895] (5 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
![]() | Protein Response regulator DrrB [88988] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [88989] (1 PDB entry) |
![]() | Domain d1p2fa1: 1p2f A:121-217 [87720] Other proteins in same PDB: d1p2fa2 complexed with mse |
PDB Entry: 1p2f (more details), 1.8 Å
SCOP Domain Sequences for d1p2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p2fa1 a.4.6.1 (A:121-217) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} glydfgdlkidatgftvflkgkrihlpkkefeillflaenagkvvtreklletfwedpvs prvvdtvikrirkaieddpnrpryiktiwgvgymftg
Timeline for d1p2fa1: