SCOP 1.65: Domain d1p2fa1: 1p2f A:121-217

Lineage for d1p2fa1 (1p2f A:121-217)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.1: PhoB-like [46895] (3 proteins)
   contains 4-stranded meander beta-sheet in the N-terminal extension

6. Protein Response regulator DrrB [88988] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [88989] (1 PDB entry)

8. Domain d1p2fa1: 1p2f A:121-217 [87720]
   Other proteins in same PDB: d1p2fa2
   complexed with mse

Details for d1p2fa1

PDB Entry: 1p2f, 1.8 Å

PDB Description: crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog

SCOP Domain Sequences for d1p2fa1:

Sequence; same for both SEQRES and ATOM records:

>d1p2fa1 a.4.6.1 (A:121-217) Response regulator DrrB {Thermotoga maritima}
glydfgdlkidatgftvflkgkrihlpkkefeillflaenagkvvtreklletfwedpvs
prvvdtvikrirkaieddpnrpryiktiwgvgymftg

Timeline for d1p2fa1:

• d1p2fa1 is new in SCOP 1.65
  
• d1p2fa1 appears in SCOP 1.67
  
• d1p2fa1 appears in the current release, SCOPe 2.08