Lineage for d1oqca_ (1oqc A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765783Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (1 family) (S)
  5. 765784Family a.24.15.1: FAD-dependent thiol oxidase [69001] (2 proteins)
  6. 765785Protein Augmenter of liver regeneration [89018] (1 species)
    a mammalian FAD-dependent sulfhydryl oxidase
  7. 765786Species Rat (Rattus norvegicus) [TaxId:10116] [89019] (1 PDB entry)
  8. 765787Domain d1oqca_: 1oqc A: [87264]

Details for d1oqca_

PDB Entry: 1oqc (more details), 1.8 Å

PDB Description: The crystal structure of augmenter of liver regeneration: a mammalian FAD dependent sulfhydryl oxidase
PDB Compounds: (A:) Augmenter of liver regeneration

SCOP Domain Sequences for d1oqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqca_ a.24.15.1 (A:) Augmenter of liver regeneration {Rat (Rattus norvegicus) [TaxId: 10116]}
edcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkr
idrsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

SCOP Domain Coordinates for d1oqca_:

Click to download the PDB-style file with coordinates for d1oqca_.
(The format of our PDB-style files is described here.)

Timeline for d1oqca_: