Lineage for d1mkza_ (1mkz A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like foldSuperfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) 
Family c.57.1.1: MogA-like [53219] (5 proteins) 
Protein MoaB [89722] (2 species) Species Escherichia coli [TaxId:562] [89723] (2 PDB entries)
Uniprot P30746
Domain d1mkza_: 1mkz A: [84998]
Details for d1mkza_
PDB Entry: 1mkz (more details), 1.6 Å
PDB Description: crystal structure of moab protein at 1.6 a resolution.
PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein BSCOP Domain Sequences for d1mkza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkza_ c.57.1.1 (A:) MoaB {Escherichia coli [TaxId: 562]}
qvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvs
awiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsr
avagvanktlilampgstkacrtaweniiapqldartrpcnfhphlkkgs
SCOP Domain Coordinates for d1mkza_:
Click to download the PDB-style file with coordinates for d1mkza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mkza_:
- d1mkza_ first appeared in SCOP 1.65
- d1mkza_ appears in SCOP 1.73
- d1mkza_ appears in SCOPe 2.01
- d1mkza_ appears in the current release, SCOPe 2.08, called d1mkza1
View in 3D
