Lineage for d1ni3a2 (1ni3 A:307-388)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854861Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 854875Family d.15.10.2: G domain-linked domain [82583] (2 proteins)
  6. 854879Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species)
    N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain
  7. 854880Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82585] (1 PDB entry)
  8. 854881Domain d1ni3a2: 1ni3 A:307-388 [80532]
    Other proteins in same PDB: d1ni3a1
    complexed with mse, so4

Details for d1ni3a2

PDB Entry: 1ni3 (more details), 2.8 Å

PDB Description: structure of the schizosaccharomyces pombe ychf gtpase
PDB Compounds: (A:) YchF GTP-binding protein

SCOP Domain Sequences for d1ni3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
linyftcgedevrswtirkgtkapqaagvihtdfekafvvgeimhyqdlfdyktenacra
agkyltkgkeyvmesgdiahwk

SCOP Domain Coordinates for d1ni3a2:

Click to download the PDB-style file with coordinates for d1ni3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ni3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ni3a1