Lineage for d1ni3a1 (1ni3 A:11-306)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (78 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein YchF GTP-binding protein N-terminal domain [82410] (2 species)
Member of the Obg family of GTPases; contains an alpha-hairpin insert subdomain
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82411] (1 PDB entry) 
Domain d1ni3a1: 1ni3 A:11-306 [80531]
Other proteins in same PDB: d1ni3a2
complexed with mse, so4
Details for d1ni3a1
PDB Entry: 1ni3 (more details), 2.8 Å
PDB Description: structure of the schizosaccharomyces pombe ychf gtpase
PDB Compounds: (A:) YchF GTP-binding proteinSCOP Domain Sequences for d1ni3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
kvqwgrpgnnlktgivgmpnvgkstffraitksvlgnpanypyatidpeeakvavpderf
dwlceaykpksrvpafltvfdiagltkgastgvglgnaflshvravdaiyqvvrafddae
iihvegdvdpirdlsiivdellikdaefvekhleglrkitsrgantlemkakkeeqaiie
kvyqyltetkqpirkgdwsnreveiinslylltakpviylvnmserdflrqknkylpkik
kwidenspgdtlipmsvafeerltnfteeeaieeckklntksmlpkiivtgynaln
SCOP Domain Coordinates for d1ni3a1:
Click to download the PDB-style file with coordinates for d1ni3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ni3a1:
- d1ni3a1 first appeared in SCOP 1.63
- d1ni3a1 appears in SCOP 1.73
- d1ni3a1 appears in SCOPe 2.01
- d1ni3a1 appears in the current release, SCOPe 2.08
View in 3D
