Lineage for d1mmua_ (1mmu A:)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.30: Supersandwich [49993] (3 superfamilies)
sandwich; 18 strands in 2 sheetsSuperfamily b.30.5: Galactose mutarotase-like [74650] (11 families) 
probable carbohydrate-binding domain in enzymes acting on sugars
Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins) Protein Galactose mutarotase [74912] (3 species) Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries) 
Domain d1mmua_: 1mmu A: [79303]
Details for d1mmua_
PDB Entry: 1mmu (more details), 1.8 Å
PDB Description: crystal structure of galactose mutarotase from lactococcus lactis complexed with d-glucose
PDB Compounds: (A:) aldose 1-epimeraseSCOP Domain Sequences for d1mmua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmua_ b.30.5.4 (A:) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
tfecqvspgseqipelgdislkagekyqattiyslhtkl
SCOP Domain Coordinates for d1mmua_:
Click to download the PDB-style file with coordinates for d1mmua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mmua_:
- d1mmua_ first appeared in SCOP 1.63
- d1mmua_ appears in SCOP 1.73
- d1mmua_ appears in SCOPe 2.01
- d1mmua_ appears in the current release, SCOPe 2.08, called d1mmua1
View in 3D
