Lineage for d1mc0a1 (1mc0 A:215-401)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870687Superfamily d.110.2: GAF domain-like [55781] (4 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 870688Family d.110.2.1: GAF domain [55782] (7 proteins)
  6. 870689Protein 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains [82760] (1 species)
    GAF B is the nucleotide binding domain; the two domains are connected with a long helix;
  7. 870690Species Mouse (Mus musculus) [TaxId:10090] [82761] (1 PDB entry)
  8. 870691Domain d1mc0a1: 1mc0 A:215-401 [78937]

Details for d1mc0a1

PDB Entry: 1mc0 (more details), 2.86 Å

PDB Description: Regulatory Segment of Mouse 3',5'-Cyclic Nucleotide Phosphodiesterase 2A, Containing the GAF A and GAF B Domains
PDB Compounds: (A:) 3',5'-cyclic nucleotide phosphodiesterase 2A

SCOP Domain Sequences for d1mc0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc0a1 d.110.2.1 (A:215-401) 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains {Mouse (Mus musculus) [TaxId: 10090]}
ytdhdrkilqlcgelfdldatslqlkvlqylqqetqathcclllvsednlqlsckvigdk
vlgeevsfpltmgrlgqvvedkqciqlkdltsddvqqlqnmlgcelqamlcvpvisratd
qvvalacafnklggdfftdedehviqhcfhytgtvltstlafqkeqklkcecqallqvak
nlfthld

SCOP Domain Coordinates for d1mc0a1:

Click to download the PDB-style file with coordinates for d1mc0a1.
(The format of our PDB-style files is described here.)

Timeline for d1mc0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mc0a2