Class a: All alpha proteins [46456] (284 folds) |
Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily) core: 4 helices: bundle; flanked by two short beta-hairpins duplication: consists of two structural repeats |
Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) |
Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein) |
Protein Pre-protein crosslinking domain of SecA [81769] (2 species) |
Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries) Uniprot P28366 |
Domain d1m6na1: 1m6n A:227-348 [78697] Other proteins in same PDB: d1m6na2, d1m6na3, d1m6na4 complexed with so4 |
PDB Entry: 1m6n (more details), 2.7 Å
SCOP Domain Sequences for d1m6na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6na1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]} aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq ne
Timeline for d1m6na1: