Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Obg GTP-binding protein middle domain [82408] (2 species) |
Species Bacillus subtilis [TaxId:1423] [82409] (1 PDB entry) |
Domain d1lnza2: 1lnz A:158-342 [78113] Other proteins in same PDB: d1lnza1, d1lnzb1 |
PDB Entry: 1lnz (more details), 2.6 Å
SCOP Domain Sequences for d1lnza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} ladvglvgfpsvgkstllsvvssakpkiadyhfttlvpnlgmvetddgrsfvmadlpgli egahqgvglghqflrhiertrvivhvidmsglegrdpyddyltinqelseynlrlterpq iivankmdmpeaaenleafkekltddypvfpisavtreglrellfevanqlentpefply deeel
Timeline for d1lnza2: