Lineage for d1lnza2 (1lnz A:158-342)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988107Protein Obg GTP-binding protein middle domain [82408] (2 species)
  7. 988108Species Bacillus subtilis [TaxId:1423] [82409] (1 PDB entry)
  8. 988109Domain d1lnza2: 1lnz A:158-342 [78113]
    Other proteins in same PDB: d1lnza1, d1lnzb1
    complexed with g4p, mg

Details for d1lnza2

PDB Entry: 1lnz (more details), 2.6 Å

PDB Description: Structure of the Obg GTP-binding protein
PDB Compounds: (A:) SPO0B-associated GTP-binding protein

SCOPe Domain Sequences for d1lnza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}
ladvglvgfpsvgkstllsvvssakpkiadyhfttlvpnlgmvetddgrsfvmadlpgli
egahqgvglghqflrhiertrvivhvidmsglegrdpyddyltinqelseynlrlterpq
iivankmdmpeaaenleafkekltddypvfpisavtreglrellfevanqlentpefply
deeel

SCOPe Domain Coordinates for d1lnza2:

Click to download the PDB-style file with coordinates for d1lnza2.
(The format of our PDB-style files is described here.)

Timeline for d1lnza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lnza1