Lineage for d1lnza1 (1lnz A:1-157)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812391Fold b.117: Obg-fold [82050] (1 superfamily)
    this fold is formed by three glycine-rich regions inserted into a small 8-stranded beta-sandwich
    these regions form six left-handed collagen-like helices packed and H-bonded together
  4. 812392Superfamily b.117.1: Obg GTP-binding protein N-terminal domain [82051] (1 family) (S)
  5. 812393Family b.117.1.1: Obg GTP-binding protein N-terminal domain [82052] (1 protein)
  6. 812394Protein Obg GTP-binding protein N-terminal domain [82053] (2 species)
  7. 812395Species Bacillus subtilis [TaxId:1423] [82054] (1 PDB entry)
  8. 812396Domain d1lnza1: 1lnz A:1-157 [78112]
    Other proteins in same PDB: d1lnza2, d1lnzb2

Details for d1lnza1

PDB Entry: 1lnz (more details), 2.6 Å

PDB Description: structure of the obg gtp-binding protein
PDB Compounds: (A:) SPO0B-associated GTP-binding protein

SCOP Domain Sequences for d1lnza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnza1 b.117.1.1 (A:1-157) Obg GTP-binding protein N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mfvdqvkvyvkggdggngmvafrrekyvpkggpaggdggkggdvvfevdeglrtlmdfry
kkhfkairgehgmsknqhgrnaddmvikvppgtvvtdddtkqviadltehgqraviargg
rggrgnsrfatpanpapqlsengepgkeryivlelkv

SCOP Domain Coordinates for d1lnza1:

Click to download the PDB-style file with coordinates for d1lnza1.
(The format of our PDB-style files is described here.)

Timeline for d1lnza1:

812396
d1lnza1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1lnza2