![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.117: Obg-fold [82050] (1 superfamily) this fold is formed by three glycine-rich regions inserted into a small 8-stranded beta-sandwich these regions form six left-handed collagen-like helices packed and H-bonded together |
![]() | Superfamily b.117.1: Obg GTP-binding protein N-terminal domain [82051] (1 family) ![]() |
![]() | Family b.117.1.1: Obg GTP-binding protein N-terminal domain [82052] (1 protein) |
![]() | Protein Obg GTP-binding protein N-terminal domain [82053] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [82054] (1 PDB entry) |
![]() | Domain d1lnza1: 1lnz A:1-157 [78112] Other proteins in same PDB: d1lnza2, d1lnzb2 complexed with g4p, mg |
PDB Entry: 1lnz (more details), 2.6 Å
SCOPe Domain Sequences for d1lnza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnza1 b.117.1.1 (A:1-157) Obg GTP-binding protein N-terminal domain {Bacillus subtilis [TaxId: 1423]} mfvdqvkvyvkggdggngmvafrrekyvpkggpaggdggkggdvvfevdeglrtlmdfry kkhfkairgehgmsknqhgrnaddmvikvppgtvvtdddtkqviadltehgqraviargg rggrgnsrfatpanpapqlsengepgkeryivlelkv
Timeline for d1lnza1: