Lineage for d1krha2 (1krh A:206-338)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827305Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 827306Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 827388Family c.25.1.2: Aromatic dioxygenase reductase-like [52359] (3 proteins)
    contains additional 2Fe-2S ferredoxin domain at one of the termini
  6. 827389Protein Benzoate dioxygenase reductase [75156] (1 species)
  7. 827390Species Acinetobacter sp. [TaxId:472] [75157] (1 PDB entry)
  8. 827391Domain d1krha2: 1krh A:206-338 [72892]
    Other proteins in same PDB: d1krha1, d1krha3, d1krhb1, d1krhb3

Details for d1krha2

PDB Entry: 1krh (more details), 1.5 Å

PDB Description: x-ray structure of benzoate dioxygenase reductase
PDB Compounds: (A:) Benzoate 1,2-Dioxygenase Reductase

SCOP Domain Sequences for d1krha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]}
lrdvkrpvlmlaggtgiapflsmlqvleqkgsehpvrlvfgvtqdcdlvaleqldalqqk
lpwfeyrtvvahaesqherkgyvtghieydwlnggevdvylcgpvpmveavrswldtqgi
qpanflfekfsan

SCOP Domain Coordinates for d1krha2:

Click to download the PDB-style file with coordinates for d1krha2.
(The format of our PDB-style files is described here.)

Timeline for d1krha2: