Lineage for d1krha3 (1krh A:2-105)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854217Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 854326Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 854340Protein Benzoate dioxygenase reductase, N-terminal domain [75368] (1 species)
  7. 854341Species Acinetobacter sp. [TaxId:472] [75369] (1 PDB entry)
  8. 854342Domain d1krha3: 1krh A:2-105 [72893]
    Other proteins in same PDB: d1krha1, d1krha2, d1krhb1, d1krhb2
    CASP4

Details for d1krha3

PDB Entry: 1krh (more details), 1.5 Å

PDB Description: x-ray structure of benzoate dioxygenase reductase
PDB Compounds: (A:) Benzoate 1,2-Dioxygenase Reductase

SCOP Domain Sequences for d1krha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]}
snhqvalqfedgvtrficiaqgetlsdaayrqqinipmdcregecgtcrafcesgnydmp
ednyiedaltpeeaqqgyvlacqcrptsdavfqiqassevcktk

SCOP Domain Coordinates for d1krha3:

Click to download the PDB-style file with coordinates for d1krha3.
(The format of our PDB-style files is described here.)

Timeline for d1krha3: