Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Benzoate dioxygenase reductase [74959] (1 species) |
Species Acinetobacter sp. [TaxId:472] [74960] (1 PDB entry) |
Domain d1krha1: 1krh A:106-205 [72891] Other proteins in same PDB: d1krha2, d1krha3, d1krhb2, d1krhb3 contains 2Fe-2S cluster in the C-terminal extension |
PDB Entry: 1krh (more details), 1.5 Å
SCOP Domain Sequences for d1krha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} ihhfegtlarvenlsdstitfdiqlddgqpdihflagqyvnvtlpgttetrsysfssqpg nrltgfvvrnvpqgkmseylsvqakagdkmsftgpfgsfy
Timeline for d1krha1: