Lineage for d1i60a_ (1i60 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818659Superfamily c.1.15: Xylose isomerase-like [51658] (7 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 818851Family c.1.15.4: IolI-like [75090] (3 proteins)
  6. 818852Protein Hypothetical protein IolI [75091] (1 species)
  7. 818853Species Bacillus subtilis [TaxId:1423] [75092] (2 PDB entries)
  8. 818854Domain d1i60a_: 1i60 A: [71118]
    Structural genomics
    complexed with mse

Details for d1i60a_

PDB Entry: 1i60 (more details), 1.6 Å

PDB Description: structural genomics, ioli protein
PDB Compounds: (A:) ioli protein

SCOP Domain Sequences for d1i60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]}
mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhi
kplalnalvffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikks
svdvltelsdiaepygvkialefvghpqctvntfeqayeivntvnrdnvglvldsfhfha
mgsnieslkqadgkkifiyhiddtedfpigfltdedrvwpgqgaidldahlsalkeigfs
dvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm

SCOP Domain Coordinates for d1i60a_:

Click to download the PDB-style file with coordinates for d1i60a_.
(The format of our PDB-style files is described here.)

Timeline for d1i60a_: