Lineage for d1k92a1 (1k92 A:1-188)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) 
share similar mode of ligand (Adenosine group) binding
can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other groupFamily c.26.2.1: N-type ATP pyrophosphatases [52403] (8 proteins) 
Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species) Species Escherichia coli [TaxId:562] [69459] (4 PDB entries) 
Domain d1k92a1: 1k92 A:1-188 [68325]
Other proteins in same PDB: d1k92a2
complexed with cry, so4; mutant
Details for d1k92a1
PDB Entry: 1k92 (more details), 1.6 Å
PDB Description: Crystal Structure of Uncomplexed E. coli Argininosuccinate Synthetase
PDB Compounds: (A:) argininosuccinate synthaseSCOP Domain Sequences for d1k92a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}
ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
dykmsvek
SCOP Domain Coordinates for d1k92a1:
Click to download the PDB-style file with coordinates for d1k92a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k92a1:
- d1k92a1 first appeared in SCOP 1.59
- d1k92a1 appears in SCOP 1.73
- d1k92a1 appears in SCOPe 2.01
- d1k92a1 appears in the current release, SCOPe 2.08
View in 3D
