Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (8 proteins) |
Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species) |
Species Escherichia coli [TaxId:562] [69459] (4 PDB entries) |
Domain d1k92a1: 1k92 A:1-188 [68325] Other proteins in same PDB: d1k92a2 complexed with cry, so4; mutant |
PDB Entry: 1k92 (more details), 1.6 Å
SCOP Domain Sequences for d1k92a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf dykmsvek
Timeline for d1k92a1: