Lineage for d1jpya_ (1jpy A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891138Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 891139Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 891340Family g.17.1.6: Interleukin 17F, IL-17F [69955] (1 protein)
  6. 891341Protein Interleukin 17F, IL-17F [69956] (1 species)
  7. 891342Species Human (Homo sapiens) [TaxId:9606] [69957] (1 PDB entry)
  8. 891343Domain d1jpya_: 1jpy A: [67065]

Details for d1jpya_

PDB Entry: 1jpy (more details), 2.85 Å

PDB Description: crystal structure of il-17f
PDB Compounds: (A:) interleukin 17F

SCOP Domain Sequences for d1jpya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpya_ g.17.1.6 (A:) Interleukin 17F, IL-17F {Human (Homo sapiens) [TaxId: 9606]}
htffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsev
vqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvtp
v

SCOP Domain Coordinates for d1jpya_:

Click to download the PDB-style file with coordinates for d1jpya_.
(The format of our PDB-style files is described here.)

Timeline for d1jpya_: