SCOP 1.75: Domain d1jpyy_: 1jpy Y:

Lineage for d1jpyy_ (1jpy Y:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.6: Interleukin 17F, IL-17F [69955] (1 protein)

6. Protein Interleukin 17F, IL-17F [69956] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69957] (1 PDB entry)

8. Domain d1jpyy_: 1jpy Y: [67068]
   complexed with nag, so4

Details for d1jpyy_

PDB Entry: 1jpy, 2.85 Å

PDB Description: crystal structure of il-17f

PDB Compounds: (Y:) interleukin 17F

SCOP Domain Sequences for d1jpyy_:

Sequence, based on SEQRES records:

>d1jpyy_ g.17.1.6 (Y:) Interleukin 17F, IL-17F {Human (Homo sapiens) [TaxId: 9606]}
vghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnryps
evvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcv
tpvih

Sequence, based on observed residues (ATOM records):

>d1jpyy_ g.17.1.6 (Y:) Interleukin 17F, IL-17F {Human (Homo sapiens) [TaxId: 9606]}
vghtffqkpescpsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsevvqa
qcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvtpvih

Timeline for d1jpyy_:

• d1jpyy_ first appeared in SCOP 1.59
  
• d1jpyy_ appears in SCOP 1.73
  
• d1jpyy_ appears in SCOPe 2.01
  
• d1jpyy_ appears in the current release, SCOPe 2.08