Lineage for d1hnna_ (1hnn A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) 
Family c.66.1.15: Arylamine N-methyltransferase [69547] (2 proteins) 
Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69549] (12 PDB entries) 
Domain d1hnna_: 1hnn A: [65895]
Details for d1hnna_
PDB Entry: 1hnn (more details), 2.4 Å
PDB Description: crystal structure of human pnmt complexed with sk&f 29661 and adohcy(sah)
PDB Compounds: (A:) Phenylethanolamine N-methyltransferaseSCOP Domain Sequences for d1hnna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnna_ c.66.1.15 (A:) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
avasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsg
ptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwq
dkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhi
ttllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpah
lqtgvddvkgvffawaqkvgl
SCOP Domain Coordinates for d1hnna_:
Click to download the PDB-style file with coordinates for d1hnna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnna_:
- d1hnna_ first appeared in SCOP 1.59
- d1hnna_ appears in SCOP 1.73
- d1hnna_ appears in SCOPe 2.01
- d1hnna_ appears in the current release, SCOPe 2.08
View in 3D
