Lineage for d1hnna_ (1hnn A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125716Family c.66.1.15: Phenylethanolamine N-methyltransferase, PNMTase [69547] (1 protein)
  6. 125717Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)
  7. 125718Species Human (Homo sapiens) [TaxId:9606] [69549] (1 PDB entry)
  8. 125719Domain d1hnna_: 1hnn A: [65895]

Details for d1hnna_

PDB Entry: 1hnn (more details), 2.4 Å

PDB Description: crystal structure of human pnmt complexed with sk&f 29661 and adohcy(sah)

SCOP Domain Sequences for d1hnna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnna_ c.66.1.15 (A:) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens)}
avasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsg
ptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwq
dkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhi
ttllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpah
lqtgvddvkgvffawaqkvgl

SCOP Domain Coordinates for d1hnna_:

Click to download the PDB-style file with coordinates for d1hnna_.
(The format of our PDB-style files is described here.)

Timeline for d1hnna_: