Lineage for d1jmta_ (1jmt A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862050Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) (S)
  5. 862464Family d.58.7.3: Splicing factor U2AF subunits [64276] (1 protein)
  6. 862465Protein U2AF35 (35 KDa subunit) [64277] (1 species)
  7. 862466Species Human (Homo sapiens) [TaxId:9606] [64278] (1 PDB entry)
  8. 862467Domain d1jmta_: 1jmt A: [63180]
    heterodimer with a fragment U2AF65 subunit; chain B
    complexed with hez; mutant

Details for d1jmta_

PDB Entry: 1jmt (more details), 2.2 Å

PDB Description: x-ray structure of a core u2af65/u2af35 heterodimer
PDB Compounds: (A:) splicing factor u2af 35 kda subunit

SCOP Domain Sequences for d1jmta_:

Sequence, based on SEQRES records: (download)

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}
sqtiallniyrnpqnssqsadglrsavsdvemqehydeffeevftemeekygeveemnvc
dnlgdhlvgnvyvkfrreedaekavidlnnrwfngqpihaelsp

Sequence, based on observed residues (ATOM records): (download)

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}
sqtiallniyrnpqdglrsavsdvemqehydeffeevftemeekygeveemnvcdnlgdh
lvgnvyvkfrreedaekavidlnnrwfngqpihaelsp

SCOP Domain Coordinates for d1jmta_:

Click to download the PDB-style file with coordinates for d1jmta_.
(The format of our PDB-style files is described here.)

Timeline for d1jmta_: