Lineage for d1jmta_ (1jmt A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80286Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 80392Family d.58.7.3: Splicing factor U2AF subunits [64276] (1 protein)
  6. 80393Protein U2AF35 (35 KDa subunit) [64277] (1 species)
  7. 80394Species Human (Homo sapiens) [TaxId:9606] [64278] (1 PDB entry)
  8. 80395Domain d1jmta_: 1jmt A: [63180]

Details for d1jmta_

PDB Entry: 1jmt (more details), 2.2 Å

PDB Description: x-ray structure of a core u2af65/u2af35 heterodimer

SCOP Domain Sequences for d1jmta_:

Sequence, based on SEQRES records: (download)

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens)}
sqtiallniyrnpqnssqsadglrsavsdvemqehydeffeevftemeekygeveemnvc
dnlgdhlvgnvyvkfrreedaekavidlnnrwfngqpihaelsp

Sequence, based on observed residues (ATOM records): (download)

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens)}
sqtiallniyrnpqdglrsavsdvemqehydeffeevftemeekygeveemnvcdnlgdh
lvgnvyvkfrreedaekavidlnnrwfngqpihaelsp

SCOP Domain Coordinates for d1jmta_:

Click to download the PDB-style file with coordinates for d1jmta_.
(The format of our PDB-style files is described here.)

Timeline for d1jmta_: