Lineage for d1jfxa_ (1jfx A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816722Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (3 proteins)
    Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
    permutation of the common fold; strand 8 is antiparallel to the rest of the barrel
  6. 816731Protein Streptomyces lysozyme [63913] (1 species)
    supersedes and corrects the old structure from S. erythraeus; 0LZ6
  7. 816732Species Streptomyces coelicolor, "mueller" dsm3030 [TaxId:1902] [63914] (1 PDB entry)
  8. 816733Domain d1jfxa_: 1jfx A: [62943]
    complexed with cl

Details for d1jfxa_

PDB Entry: 1jfx (more details), 1.65 Å

PDB Description: Crystal structure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution
PDB Compounds: (A:) 1,4-beta-N-Acetylmuramidase M1

SCOP Domain Sequences for d1jfxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfxa_ c.1.8.8 (A:) Streptomyces lysozyme {Streptomyces coelicolor, "mueller" dsm3030 [TaxId: 1902]}
dtsgvqgidvshwqgsinwssvksagmsfayikategtnykddrfsanytnaynagiirg
ayhfarpnassgtaqadyfasngggwsrdnrtlpgvldiehnpsgamcyglsttqmrtwi
ndfharykarttrdvviyttaswwntctgswngmaakspfwvahwgvsaptvpsgfptwt
fwqysatgrvggvsgdvdrnkfngsaarllalannta

SCOP Domain Coordinates for d1jfxa_:

Click to download the PDB-style file with coordinates for d1jfxa_.
(The format of our PDB-style files is described here.)

Timeline for d1jfxa_: