PDB entry 1jfx

View 1jfx on RCSB PDB site
Description: Crystal structure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution
Class: hydrolase
Keywords: beta-alpha-barrel, Cellosyl, lysozyme, N-acetylmuramidase
Deposited on 2001-06-22, released 2001-09-05
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.152
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 1,4-beta-N-Acetylmuramidase M1
  Species: Streptomyces coelicolor
  Gene: cel
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25310 (0-216)
  Domains in SCOP 1.75: d1jfxa_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jfxA (A:)
  dtsgvqgidvshwqgsinwssvksagmsfayikategtnykddrfsanytnaynagiirg
  ayhfarpnassgtaqadyfasngggwsrdnrtlpgvldiehnpsgamcyglsttqmrtwi
  ndfharykarttrdvviyttaswwntctgswngmaakspfwvahwgvsaptvpsgfptwt
  fwqysatgrvggvsgdvdrnkfngsaarllalannta