Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families) |
Family c.52.1.18: Hjc-like [64080] (2 proteins) Pfam PF01870 |
Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries) |
Domain d1gefa_: 1gef A: [60465] |
PDB Entry: 1gef (more details), 2 Å
SCOP Domain Sequences for d1gefa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gefa_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus [TaxId: 2261]} myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllgiqktle
Timeline for d1gefa_: