Lineage for d1gefa_ (1gef A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835443Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 835444Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families) (S)
  5. 835643Family c.52.1.18: Hjc-like [64080] (2 proteins)
    Pfam PF01870
  6. 835644Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 835645Species Archaeon Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries)
  8. 835646Domain d1gefa_: 1gef A: [60465]

Details for d1gefa_

PDB Entry: 1gef (more details), 2 Å

PDB Description: Crystal structure of the archaeal holliday junction resolvase HJC
PDB Compounds: (A:) holliday junction resolvase

SCOP Domain Sequences for d1gefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gefa_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus [TaxId: 2261]}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllgiqktle

SCOP Domain Coordinates for d1gefa_:

Click to download the PDB-style file with coordinates for d1gefa_.
(The format of our PDB-style files is described here.)

Timeline for d1gefa_: