Lineage for d1gefa_ (1gef A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71527Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 71528Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families) (S)
  5. 71693Family c.52.1.18: Archaeal Holliday junction resolvase Hjc [64080] (1 protein)
  6. 71694Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 71695Species Archaeon Pyrococcus furiosus [TaxId:2261] [64082] (1 PDB entry)
  8. 71696Domain d1gefa_: 1gef A: [60465]

Details for d1gefa_

PDB Entry: 1gef (more details), 2 Å

PDB Description: Crystal structure of the archaeal holliday junction resolvase HJC

SCOP Domain Sequences for d1gefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gefa_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllgiqktle

SCOP Domain Coordinates for d1gefa_:

Click to download the PDB-style file with coordinates for d1gefa_.
(The format of our PDB-style files is described here.)

Timeline for d1gefa_: