Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
Protein Molybdate-binding protein, ModA [53883] (3 species) |
Species Azotobacter vinelandii [TaxId:354] [53885] (1 PDB entry) |
Domain d1atga_: 1atg A: [35834] complexed with act, edo, so4, wo4 |
PDB Entry: 1atg (more details), 1.2 Å
SCOP Domain Sequences for d1atga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} elkvvtatnflgtleqlagqfakqtghavvissgssgpvyaqivngapynvffsadeksp ekldnqgfalpgsrftyaigklvlwsakpglvdnqgkvlagngwrhiaisnpqiapygla gtqvlthlglldkltaqeriveansvgqahsqtasgaadlgfvalaqiiqaaakipgshw fppanyyepivqqavitkstaekanaeqfmswmkgpkavaiikaagyvlpq
Timeline for d1atga_: