Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins) closely related to the Proline iminopeptidase-like family |
Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species) |
Species Rhodococcus sp., strain rha1 [TaxId:1831] [53524] (1 PDB entry) |
Domain d1c4xa_: 1c4x A: [34684] |
PDB Entry: 1c4x (more details), 2.4 Å
SCOP Domain Sequences for d1c4xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} tveiiekrfpsgtlashalvagdpqspavvllhgagpgahaasnwrpiipdlaenffvva pdligfgqseypetypghimswvgmrveqilglmnhfgiekshivgnsmggavtlqlvve aperfdkvalmgsvgapmnarppelarllafyadprltpyrelihsfvydpenfpgmeei vksrfevandpevrriqevmfesmkagmeslvippatlgrlphdvlvfhgrqdrivpldt slyltkhlkhaelvvldrcghwaqlerwdamgpmlmehfra
Timeline for d1c4xa_: