Lineage for d1c4xa_ (1c4x A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842289Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
    closely related to the Proline iminopeptidase-like family
  6. 842290Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species)
  7. 842296Species Rhodococcus sp., strain rha1 [TaxId:1831] [53524] (1 PDB entry)
  8. 842297Domain d1c4xa_: 1c4x A: [34684]

Details for d1c4xa_

PDB Entry: 1c4x (more details), 2.4 Å

PDB Description: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1
PDB Compounds: (A:) protein (2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase)

SCOP Domain Sequences for d1c4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}
tveiiekrfpsgtlashalvagdpqspavvllhgagpgahaasnwrpiipdlaenffvva
pdligfgqseypetypghimswvgmrveqilglmnhfgiekshivgnsmggavtlqlvve
aperfdkvalmgsvgapmnarppelarllafyadprltpyrelihsfvydpenfpgmeei
vksrfevandpevrriqevmfesmkagmeslvippatlgrlphdvlvfhgrqdrivpldt
slyltkhlkhaelvvldrcghwaqlerwdamgpmlmehfra

SCOP Domain Coordinates for d1c4xa_:

Click to download the PDB-style file with coordinates for d1c4xa_.
(The format of our PDB-style files is described here.)

Timeline for d1c4xa_: